PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof001764
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 370aa    MW: 40611.9 Da    PI: 4.9145
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-36701PU_refplantGDBView CDS
gnl|UG|Sof#S17328648PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.35.4e-11160201245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++WT e  +ll+++++++    W+ Ia ++g +++  qc+ ++ 
        Sof001764 160 DKWTDEQTLLLLEGIEKYNDT-WDDIAGHVG-TKSKAQCIYHFI 201
                      69****************855.*********.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129319.365157208IPR017884SANT domain
SMARTSM007177.2E-9158206IPR001005SANT/Myb domain
SuperFamilySSF466891.42E-11159209IPR009057Homeodomain-like
PfamPF002492.1E-10160202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-6160200IPR009057Homeodomain-like
CDDcd001675.73E-8161203No hitNo description
PfamPF164955.5E-12333370IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
XSRFVRFLDT WGIINYLAAG SVHRGLRMAT SLLREEPTGE LQLLTAPLKS IDGLILFDRP  60
KCTLPAEDVS SMAASSSNSE AVDFDAAFAD LDGKIRERLS ENSCSYCLQP LPSLHYRSQK  120
EADTFLCSDC FHDARYITGH SSLDFQRVDG DNDGSENDSD KWTDEQTLLL LEGIEKYNDT  180
WDDIAGHVGT KSKAQCIYHF IRLPVEDGLL ENVEIPNAAI PFRPQSNGYQ HSDSNGSTSV  240
QNIQQGNQLP FINSSNPVMS LVAFLASSIG PRVAASCAHA ALSFLTRDDD SRVNSEGMHV  300
DGMGNGANPN FQNHNGASPS ISSENVKHAA MFGLSTAAMK SKLFADQEER ESQRLTATVI  360
NHQLKKMELK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.170550.0callus| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146162.10.0hypothetical protein
SwissprotQ9XI071e-112SWI3C_ARATH; SWI/SNF complex subunit SWI3C
TrEMBLB7ZZN60.0B7ZZN6_MAIZE; Uncharacterized protein
STRINGGRMZM2G139760_P010.0(Zea mays)